PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00320.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 401aa    MW: 43566.4 Da    PI: 10.2559
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00320.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.99.3e-13323375557
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                              +r+rr++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+ +  e+ ++ +
  Rsa1.0_00320.1_g00008.1 323 RRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKVNQELQRKQAEMMEMQK 375
                              69***************************************876666655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.9E-11319384IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.53321372IPR004827Basic-leucine zipper domain
PfamPF001701.9E-10323376IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-9323372No hitNo description
CDDcd147077.32E-24323375No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-12323379No hitNo description
PROSITE patternPS000360326341IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGTHINFNNL GGGGGGSNQM KPTDTAYPLA RQSSLYSLTF DELQSTLGGP GKDFGSMNMD  60
ELLKSIWTAE EAQAMTMNPP SSSSSAAAAA TAVAQPGGGG GIPLQRQGSL TLPRTISQKT  120
VDEVWKCLFT KDGNMVGSSG GESNAPQRQQ TLGEITLEEF LFRAGVVRED NCSQQVGGNS  180
SNNGFYGNNG AAAGGLGFGF GQPNQNNISF NGTIQQQTQQ QFQQQPQQQL QQPRQQLNQP  240
HPQQQQQQHP HQRLPQTIFP KQAFAGNNNN NGLGSFGGGG VTVAAAATSP GTSSAENNSL  300
SPVPYVLNRG RRSNTGLEKV IERRQRRMIK NRESAARSRA RKQAYTLELE AEIEKLKKVN  360
QELQRKQAEM MEMQKNELKE TSKQPWGSKR QCLRRTLTGP W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1228941e-170JX122894.1 Brassica napus ABA-responsive element binding factor 4 (ABF4.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013658608.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 isoform X1
SwissprotQ9M7Q21e-174AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A0D3ACD00.0A0A0D3ACD0_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.3__2145__AT3G19290.11e-180(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.15e-73ABRE binding factor 4